PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603064.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 468aa    MW: 53245.2 Da    PI: 7.0452
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603064.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP248.71.8e-1579128255
             AP2   2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                     +y+G+r +  rg++vAe++dp+   k kr++lg+f+ta +Aa+a++ a+ +l+g
  XP_009603064.1  79 RYRGIRLR--RGKFVAEVCDPTR--KGKRVWLGTFDTAIDAARAYDTAAFRLRG 128
                     7****975..6******999743..34*************************98 PP

2RWP-RK567.5e-18285333452
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      i+ e l+++F +++ dAAk+L v+ ++LKr CR+y+I+RWPh k +++
  XP_009603064.1 285 GITREILEQHFGKTLVDAAKTLRVSRSTLKRVCREYNISRWPHHKTRKV 333
                     58999****************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000181.61E-2478138No hitNo description
PfamPF008476.0E-1079128IPR001471AP2/ERF domain
PROSITE profilePS5103219.79679136IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.9E-2579136IPR001471AP2/ERF domain
SuperFamilySSF541719.81E-1879137IPR016177DNA-binding domain
SMARTSM003802.9E-2979142IPR001471AP2/ERF domain
PROSITE profilePS5151912.901268356IPR003035RWP-RK domain
PfamPF020422.1E-18286333IPR003035RWP-RK domain
SuperFamilySSF542771.18E-17380466No hitNo description
SMARTSM006662.2E-13383465IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-16383463No hitNo description
PROSITE profilePS5174519.998383465IPR000270PB1 domain
PfamPF005646.2E-15384464IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MASLQQLTLD LIRQDLLDDI IFEENYGLSE TNTSFDSKTE LNSFKFEAKA PRISSNFRKF  60
GSKTEDSVQK MENTLGTKRY RGIRLRRGKF VAEVCDPTRK GKRVWLGTFD TAIDAARAYD  120
TAAFRLRGSR AILNFPPQKK DMELRLPEIN GIFYPKDNDS QRSENNGTAL LVPHDLFNNE  180
GLEQVDLLLP HATEATVMNR GSMVNANVAH DQCNDGGEIV QPDLHFVKSF VEIDSRSNDK  240
VEHNDIARGS SSCERLLVEA DALTNIQNVD SMNKCTIARL EKDYGITREI LEQHFGKTLV  300
DAAKTLRVSR STLKRVCREY NISRWPHHKT RKVYHRVSQG VSLQSAEQYV EDTQQCPDLS  360
QEKGTDLLAH KKLPAAEKPC DNLMTLKVTY RGDIIKFQLS PSSTRVELEV EVEKRLNISL  420
QRFSIKYQDD DDDWILITSN SDLSYGMNSL RLLGRTTMKL LVTPISET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A1e-2178136160ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
2gcc_A2e-2178136463ATERF1
3gcc_A2e-2178136463ATERF1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603064.10.0PREDICTED: uncharacterized protein LOC104098108
TrEMBLA0A0V0ISB41e-105A0A0V0ISB4_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000823731e-105(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1571547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47220.13e-18ethylene responsive element binding factor 2